PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0273s00020.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 812aa    MW: 89086.2 Da    PI: 6.388
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0273s00020.3genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-162468147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Vang0273s00020.3 24 RERWTEEEHNRFLEALKLHGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.59E-161872IPR009057Homeodomain-like
PROSITE profilePS5129419.9131973IPR017930Myb domain
TIGRFAMsTIGR015571.3E-152271IPR006447Myb domain, plants
SMARTSM007171.3E-122371IPR001005SANT/Myb domain
PfamPF002492.0E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-82464IPR009057Homeodomain-like
CDDcd001671.62E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MDAYSSGEEV VVKTRKPYTI TKQRERWTEE EHNRFLEALK LHGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KIADSRAKWY RGLDKPYLGK WLSGADGGGF LFQEHILEEI HGLIDHHDKS  120
AVPTLGTGKF RDTLEKEALV KGVPIGQALD IDIPPPRPKR KPSNPYPRKT RIGTATLHSG  180
AKDGKINLVE FSHDNQALDL EKEPVPEIYD LDEGPTTVKE NKDENCSKVF TDIQEVPCSS  240
LSSANRSSIS MSVPLGNSCV FKETTTSVKE VITPDDKTES FLTVELENGN LEINGGKQAN  300
GTSKNSTLEN SDALLMKLVQ NEKTDGLDSA LTIEGMQGNN QNYPRHVTVH VVDGNLGTCT  360
QNPSQDMLFR DCMFQPIGGA NGQPNLFTNS APSNTRESQN NTARSSAHQS FLPYPPFTQH  420
NQDDYQSFLH MSSTFSNLIV STLLQNPAAH AAASFAATFW PYANPETSAD SPRCSQGGFT  480
SRHIGSPPSV VAIAAATVAA ATAWWAAHGL LPLCAPLHTA FACPPASVTA VPSMNTSETP  540
SLKAEQEKST LQNPPLHDQM MHPEYSEAPQ AQHSASKSLA VISSDSESGD VKLNTSPKAT  600
DHETNEIISE HLDSNKTKGR KQVDRSSCGS NTASSSDVET DALGKDEKGK EEPETPDANH  660
LAIEFSNRRR SICNLTDSWK EVSEEGKLAF QALFSREVLP QSFSPPHALT NKDQMGITND  720
NQQTIDDRNE DLESKKCSSI YKPMQKNPPF VENNVGLLTL GLGQGKLKTR RTGFKPYKRC  780
SMEAKENRVG ASNQGEEKCC KRIRLEGDTS T*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521593.10.0PREDICTED: protein LHY-like
RefseqXP_014521594.10.0PREDICTED: protein LHY-like
RefseqXP_014521595.10.0PREDICTED: protein LHY-like
RefseqXP_014521596.10.0PREDICTED: protein LHY-like
RefseqXP_014521597.10.0PREDICTED: protein LHY-like
RefseqXP_014521598.10.0PREDICTED: protein LHY-like
RefseqXP_014521599.10.0PREDICTED: protein LHY-like
RefseqXP_014521600.10.0PREDICTED: protein LHY-like
TrEMBLA0A0L9VQJ20.0A0A0L9VQJ2_PHAAN; Uncharacterized protein
STRINGGLYMA07G05410.40.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-101MYB_related family protein